Syt1 Rabbit Polyclonal Antibody

SKU: orb331045

Description

Rabbit polyclonal antibody to Syt1

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

−

Item 1 of 5

Tested Applications	IHC, WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Target	Syt1
Protein Sequence	Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
Molecular Weight	47kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti AW124717 antibody, anti G630098F17Rik antibody, anti SytI antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.

Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.

Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.

Quick Database Links

Gene Symbol

Syt1

UniProt

P46096

RefSeq (Protein):NP_033332

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_033332

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols