Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Syt1 Rabbit Polyclonal Antibody

SKU: orb331045

Description

Rabbit polyclonal antibody to Syt1

Research Area

Neuroscience

Images & Validation

Tested ApplicationsIHC, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetSyt1
Protein SequenceSynthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
Molecular Weight47kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AW124717 antibody, anti G630098F17Rik antibody, anti SytI antibody

Similar Products

  • Synaptotagmin 1/SYT1 Rabbit Polyclonal Antibody [orb402273]

    FC,  ICC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Synaptotagmin 1/2 (phospho Thr202/199) rabbit pAb Antibody [orb764336]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Synaptotagmin 1/2 (phospho Ser309/306) rabbit pAb Antibody [orb764335]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • SYT1 Rabbit Polyclonal Antibody [orb631672]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Synaptotagmin 1 Rabbit Polyclonal Antibody [orb4362]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Syt1 Rabbit Polyclonal Antibody

Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Syt1 Rabbit Polyclonal Antibody

Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Syt1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.

Syt1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.

Syt1 Rabbit Polyclonal Antibody

Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033332

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Syt1 Rabbit Polyclonal Antibody (orb331045)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 590.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry