Syt1 antibody

• Catalog Number: orb331045
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Syt1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: Syt1
• UniProt ID: P46096
• Protein Sequence: Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
• NCBI: NP_033332
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AW124717 antibody, anti G630098F17Rik antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of mouse retina tissue using Syt1 antibody

Immunohistochemical staining of mouse outer plexiform tissue using Syt1 antibody

Western blot analysis of mouse Spleen tissue using Syt1 antibody

Western blot analysis of mouse cortex brain tissue using Syt1 antibody