Syt1 Rabbit Polyclonal Antibody

• Catalog Number: orb331045
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Syt1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: Syt1
• UniProt ID: P46096
• Protein Sequence: Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
• NCBI: NP_033332
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AW124717 antibody, anti G630098F17Rik antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.

Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.

Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.