You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574223 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SUV39H1 |
| Target | SUV39H1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SUV39H1 |
| Protein Sequence | Synthetic peptide located within the following region: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP |
| UniProt ID | O43463 |
| MW | 48kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MG44, KMT1A, SUV39H, H3-K9-HMTase 1 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Stem Cell & Read more... |
| Note | For research use only |
| NCBI | NP_003164 |

Rabbit Anti-SUV39H1 antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SUV39H1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate, SUV39H1 is supported by BioGPS gene expression data to be expressed in 721_B.
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review