SUV39H1 Rabbit Polyclonal Antibody

• Catalog Number: orb574222
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUV39H1
• Target: SUV39H1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1
• Protein Sequence: Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
• UniProt ID: O43463
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MG44, KMT1A, SUV39H, H3-K9-HMTase 1
• Research Area: Cell Biology, Epigenetics & Chromatin, Stem Cell &
• Note: For research use only
• NCBI: NP_003164

Human Intestine

Rabbit Anti-SUV39H1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SUV39H1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, SUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2.