You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574222 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SUV39H1 |
| Target | SUV39H1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1 |
| Protein Sequence | Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF |
| UniProt ID | O43463 |
| MW | 48kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MG44, KMT1A, SUV39H, H3-K9-HMTase 1 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Stem Cell & Read more... |
| Note | For research use only |
| NCBI | NP_003164 |

Human Intestine

Rabbit Anti-SUV39H1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SUV39H1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, SUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review