STUB1 Rabbit Polyclonal Antibody

• Catalog Number: orb578700
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STUB1
• Target: STUB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Canine, Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STUB1
• Protein Sequence: Synthetic peptide located within the following region: VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF
• UniProt ID: Q9UNE7
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CHIP, SCA48, UBOX1, SCAR16, HSPABP2, NY-CO-7, SDCC
• Research Area: Molecular Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_005852

Lanes: 1: 1 ug insoluble STUB1 protein, 2: 1 ug soluble STUB1 protein, 3: 1 ug EPM2A protein, 4: 1 ug insoluble PPP1R3C protein, 5: 1 ug soluble PPP1R3C protein, Primary Antibody Dilution: 1:2500, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody Dilution: 1:20000, Gene Name: STUB1.

Lanes: Lane 1: 40 ug canine retina lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: STUB1.

Rabbit Anti-STUB1 Antibody, Catalog Number: orb578700, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.