You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578700 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STUB1 |
| Target | STUB1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Canine, Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human STUB1 |
| Protein Sequence | Synthetic peptide located within the following region: VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF |
| UniProt ID | Q9UNE7 |
| MW | 35kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CHIP, SCA48, UBOX1, SCAR16, HSPABP2, NY-CO-7, SDCC Read more... |
| Research Area | Molecular Biology, Protein Biochemistry |
| Note | For research use only |
| NCBI | NP_005852 |

Lanes: 1: 1 ug insoluble STUB1 protein, 2: 1 ug soluble STUB1 protein, 3: 1 ug EPM2A protein, 4: 1 ug insoluble PPP1R3C protein, 5: 1 ug soluble PPP1R3C protein, Primary Antibody Dilution: 1:2500, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody Dilution: 1:20000, Gene Name: STUB1.

Lanes: Lane 1: 40 ug canine retina lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: STUB1.

Rabbit Anti-STUB1 Antibody, Catalog Number: orb578700, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
IHC, WB | |
Bovine, Guinea pig, Mouse, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review