STUB1 Rabbit Polyclonal Antibody

• Catalog Number: orb578699
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STUB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STUB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: STUB1
• UniProt ID: Q9UNE7
• Protein Sequence: Synthetic peptide located within the following region: MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
• NCBI: NP_005852
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CHIP, SCA48, UBOX1, SCAR16, HSPABP2, NY-CO-7, SDCC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 1 ug insoluble STUB1 protein, 2: 1 ug soluble STUB1 protein, 3: 1 ug EPM2A protein, 4: 1 ug insoluble PPP1R3C protein, 5: 1 ug soluble PPP1R3C protein, Primary Antibody Dilution: 1:2500, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody Dilution: 1:20000, Gene Name: STUB1.

WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Spleen.