Cart summary

You have no items in your shopping cart.

STAT4 Rabbit Polyclonal Antibody

SKU: orb574631

Description

Rabbit polyclonal antibody to STAT4

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityCanine, Equine, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
TargetSTAT4
Protein SequenceSynthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
Molecular Weight86 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SLEB11

Similar Products

  • Stat4 (phospho Tyr693) rabbit pAb Antibody [orb770172]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Stat4 (phospho Tyr693) rabbit pAb Antibody [orb764282]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Stat4 rabbit pAb Antibody [orb766388]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • STAT4 Rabbit pAb Antibody [orb763757]

    IHC,  WB

    Human

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • STAT4 Rabbit Polyclonal Antibody [orb158505]

    ELISA,  ICC,  WB

    Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

STAT4 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Other isoforms containing peptide include 82 kDa, 72 kDa, 55 kDa and 40 kDa and canonical protein is phosphorylated.

STAT4 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

STAT4 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

STAT4 Rabbit Polyclonal Antibody

Human Muscle

STAT4 Rabbit Polyclonal Antibody

Rabbit Anti-STAT4 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

STAT4 Rabbit Polyclonal Antibody

WB Suggested Anti-STAT4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003142

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

STAT4 Rabbit Polyclonal Antibody (orb574631)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry