STAT4 Rabbit Polyclonal Antibody

• Catalog Number: orb574631
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STAT4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: STAT4
• UniProt ID: Q14765
• Protein Sequence: Synthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
• NCBI: NP_003142
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SLEB11
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Other isoforms containing peptide include 82 kDa, 72 kDa, 55 kDa and 40 kDa and canonical protein is phosphorylated.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Human Muscle

Rabbit Anti-STAT4 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-STAT4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat.