You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574631 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STAT4 |
| Target | STAT4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Canine, Equine, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4 |
| Protein Sequence | Synthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ |
| UniProt ID | Q14765 |
| MW | 86 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SLEB11 |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_003142 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Other isoforms containing peptide include 82 kDa, 72 kDa, 55 kDa and 40 kDa and canonical protein is phosphorylated.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Human Muscle

Rabbit Anti-STAT4 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-STAT4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat.
ELISA, IHC-P, IP, WB | |
Human, Monkey, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review