STAT1 Rabbit Polyclonal Antibody

• Catalog Number: orb576891
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STAT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 87 kDa
• Target: STAT1
• UniProt ID: P42224
• Protein Sequence: Synthetic peptide located within the following region: MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDV
• NCBI: NP_009330
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is modified by phosphorylation and methylation.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Pancreas tissue at an antibody concentration of 5.0 ug/ml using anti-STAT1 antibody (orb576891).

Rabbit Anti-STAT1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-STAT1 Antibody Titration: 1 ug/ml, Positive Control: STAT1.