SREBF2 Rabbit Polyclonal Antibody

• Catalog Number: orb592855
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SREBF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SREBF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74kDa
• Target: SREBF2
• UniProt ID: Q12772
• Protein Sequence: Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL
• NCBI: AAH51385
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SREBP2, bHLHd2, SREBP-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/ml.

Rabbit Anti-SREBF2 Antibody, Catalog Number: orb592855, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in golgi, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:7812500, Positive Control: Transfected 293T. SREBF2 is supported by BioGPS gene expression data to be expressed in HEK293T.