SREBF2 Rabbit Polyclonal Antibody

• Catalog Number: orb592752
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SREBF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SREBF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 124kDa
• Target: SREBF2
• UniProt ID: Q12772
• Protein Sequence: Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL
• NCBI: NP_004590
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SREBP2, bHLHd2, SREBP-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SREBF2 Antibody, Positive Control: Lane 1: 50 ug mouse glomerular endothelial lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Raji cell lysate. SREBF2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.