SPTAN1 Rabbit Polyclonal Antibody

• Catalog Number: orb584030
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPTAN1
• Target: SPTAN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1
• Protein Sequence: Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
• UniProt ID: Q13813
• MW: 285 kDa
• Tested applications: IHC, IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DEE5, NEAS, EIEE5, SPTA2
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_003118

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: SPTAN1, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: SPTAN1.

Immunohistochemistry with Kidney tissue at an antibody concentration of 5 ug/ml using anti-SPTAN1 antibody (orb584030).

Immunohistochemistry with NT-2 cell line.

WB Suggested Anti-SPTAN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. SPTAN1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.