You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326359 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPSB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human, Monkey |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPSB2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | SPSB2 |
UniProt ID | Q99619 |
Protein Sequence | Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG |
NCBI | NP_116030 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ17395 antibody, anti GRCC9 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.
WB Suggested Anti-SPSB2 Antibody, Titration: 1.0 ug/mL, Positive Control: COLO205 Whole Cell.
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human, Monkey | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |