You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Monkey |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPSB2 |
| Target | SPSB2 |
| Protein Sequence | Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG |
| Molecular Weight | 28kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SPSB2 Rabbit Polyclonal Antibody [orb326358]
IHC, WB
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human, Monkey
Rabbit
Polyclonal
Unconjugated
100 μlSPSB2 Rabbit Polyclonal Antibody [orb514828]
ELISA, IHC
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.

WB Suggested Anti-SPSB2 Antibody, Titration: 1.0 ug/mL, Positive Control: COLO205 Whole Cell.
Documents Download
Request a Document
Protocol Information
SPSB2 Rabbit Polyclonal Antibody (orb326359)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

