SPSB2 Rabbit Polyclonal Antibody

• Catalog Number: orb326359
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPSB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPSB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: SPSB2
• UniProt ID: Q99619
• Protein Sequence: Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG
• NCBI: NP_116030
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ17395 antibody, anti GRCC9 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.

WB Suggested Anti-SPSB2 Antibody, Titration: 1.0 ug/mL, Positive Control: COLO205 Whole Cell.