SPSB2 Rabbit Polyclonal Antibody

SKU: orb326359

Description

SPSB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SPSB2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human SPSB2. This antibody reacts with Human, Monkey samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Monkey
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPSB2
• Target: SPSB2
• Protein Sequence: Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG
• Molecular Weight: 28kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ17395 antibody, anti GRCC9 antibody, anti MGC2519 antibody, anti SSB2 antibody

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.

WB Suggested Anti-SPSB2 Antibody, Titration: 1.0 ug/mL, Positive Control: COLO205 Whole Cell.

Quick Database Links

Gene Symbol

SPSB2

UniProt

Q99619

RefSeq (Protein):NP_116030