You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb326358 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SPSB2 |
| Target | SPSB2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Monkey |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SPSB2 |
| Protein Sequence | Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR |
| UniProt ID | Q99619 |
| MW | 28kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ17395 antibody, anti GRCC9 antibody, anti Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_116030 |

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.

WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human, Monkey | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review