SPSB2 Rabbit Polyclonal Antibody

• Catalog Number: orb326358
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPSB2
• Target: SPSB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Monkey
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPSB2
• Protein Sequence: Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR
• UniProt ID: Q99619
• MW: 28kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ17395 antibody, anti GRCC9 antibody, anti
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_116030

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: SPSB2, Gene Name: SPSB2.

WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.