Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SPARC Rabbit Polyclonal Antibody

SKU: orb585551

Description

SPARC Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting SPARC. It is suitable for IHC, WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetSPARC
Protein SequenceSynthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ON, ONT, OI17, BM-40

Similar Products

  • SPARC Rabbit Polyclonal Antibody [orb11405]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SPOCK2 Rabbit Polyclonal Antibody [orb158486]

    ELISA,  WB

    Equine, Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • SPARC Rabbit Polyclonal Antibody [orb1291522]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Human

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SPARC Antibody (C-term) [orb1429584]

    FC,  IHC-P,  WB

    Mouse, Other, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SPARC-like protein 1 SPARCL1/SPARC Rabbit Polyclonal Antibody [orb106595]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SPARC Rabbit Polyclonal Antibody

Rabbit Anti-SPARC Antibody, Catalog Number: orb585551, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Plasma membrane and cytoplasm in spermatogonia and spermatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SPARC Rabbit Polyclonal Antibody

Sample Type: Adult mouse tectum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: Sparc Cyan: Nissl(Neurons), Gene Name: SPARC.

SPARC Rabbit Polyclonal Antibody

WB Suggested Anti-SPARC Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. SPARC is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003109

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SPARC Rabbit Polyclonal Antibody (orb585551)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry