SPARC Rabbit Polyclonal Antibody

• Catalog Number: orb585551
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPARC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SPARC
• UniProt ID: P09486
• Protein Sequence: Synthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
• NCBI: NP_003109
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ON, ONT, OI17, BM-40
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SPARC Antibody, Catalog Number: orb585551, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Plasma membrane and cytoplasm in spermatogonia and spermatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Adult mouse tectum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: Sparc Cyan: Nissl(Neurons), Gene Name: SPARC.

WB Suggested Anti-SPARC Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. SPARC is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.