Cart summary

You have no items in your shopping cart.

SOX9 Rabbit Polyclonal Antibody

Catalog Number: orb592879

DispatchUsually dispatched within 3-7 working days
$ 540.00
Catalog Numberorb592879
CategoryAntibodies
DescriptionRabbit polyclonal antibody to SOX9
TargetSOX9
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SOX9
Protein SequenceSynthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG
UniProt IDP48436
MW56 kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesCMD1, SRA1, CMPD1, SRXX2, SRXY10
NoteFor research use only
NCBINP_000337
SOX9 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.

SOX9 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.

SOX9 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

SOX9 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

SOX9 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX9 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate. SOX9 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

  • SOX9 Rabbit Polyclonal Antibody [orb186234]

    FC,  IF,  IHC-Fr,  IHC-P

    Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SOX9 Rabbit Polyclonal Antibody [orb500750]

    FC,  IF,  IHC-Fr,  IHC-P

    Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Sox-9 Polyclonal Antibody [orb1412128]

    IF,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Sox-9 (phospho Ser181) rabbit pAb [orb770129]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Sox-8/9/17/18 rabbit pAb [orb766355]

    ELISA,  IHC-P,  WB

    Human, Monkey, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl