SOX9 Rabbit Polyclonal Antibody

• Catalog Number: orb592879
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX9
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56 kDa
• Target: SOX9
• UniProt ID: P48436
• Protein Sequence: Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG
• NCBI: NP_000337
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CMD1, SRA1, CMPD1, SRXX2, SRXY10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-SOX9 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate. SOX9 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.