You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324994 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMR3B |
Target | SMR3B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ |
UniProt ID | P02814 |
MW | 8kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MGC104379 antibody, anti P-B antibody, anti P Read more... |
Note | For research use only |
NCBI | NP_006676 |
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
WB | |
Bovine, Human, Yeast | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Human, Yeast | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Human, Yeast | |
Rabbit | |
Polyclonal | |
Biotin |