Cart summary

You have no items in your shopping cart.

SMR3B Rabbit Polyclonal Antibody (FITC)

SMR3B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2122419

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122419
CategoryAntibodies
DescriptionSMR3B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Human, Yeast
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ
UniProt IDP02814
MW8kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesP-B, PBII, PRL3, PROL3, SMR1B
NoteFor research use only
NCBINP_006676