You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592859 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMAD6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Human, Porcine |
Reactivity | Bovine, Canine, Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 53kDa |
Target | SMAD6 |
UniProt ID | O43541 |
Protein Sequence | Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE |
NCBI | NP_005576 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AOVD2, MADH6, MADH7, HsT17432 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ELISA, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating