SMAD6 Rabbit Polyclonal Antibody

• Catalog Number: orb574337
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMAD6
• Target: SMAD6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD6
• Protein Sequence: Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR
• UniProt ID: O43541
• MW: 53kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AOVD2, MADH6, MADH7, HsT17432
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_005576

Human Heart

Human Lung

WB Suggested Anti-SMAD6 Antibody Titration: 0.5-1.0 ug/ml, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that SMAD6 is expressed in Jurkat.