SMAD4 Rabbit Polyclonal Antibody

• Catalog Number: orb574011
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMAD4
• Target: SMAD4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMAD4
• Protein Sequence: Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST
• UniProt ID: Q13485
• MW: 60 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: JIP, DPC4, MADH4, MYHRS
• Note: For research use only
• NCBI: NP_005350

Sample Type: Human nuclear cell extracts (30 ug), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit HRP, Secondary dilution: 1:20000.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Peptide is present in 60 kDa, 53 kDa, and 35 kDa isoforms, and the protein may be sumoylated or ubiquitinated.

SMAD4 antibody - middle region (orb574011) validated by WB using U2OS nuclear extracts.

WB Suggested Anti-SMAD4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.