SMAD1 Rabbit Polyclonal Antibody

• Catalog Number: orb576793
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMAD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: SMAD1
• UniProt ID: Q99717
• Protein Sequence: Synthetic peptide located within the following region: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE
• NCBI: NP_005891
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Human Skin lysate tissue.

SMAD1 antibody - N-terminal region (orb576793) validated by WB using Transfected 293T cell lysate at 2.5 ug/ul.