You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574009 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMAD1 |
Target | SMAD1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SMAD1 |
Protein Sequence | Synthetic peptide located within the following region: LAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSST |
UniProt ID | Q15797 |
MW | 52kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1 |
Note | For research use only |
NCBI | NP_005891 |
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Lanes: Lane 1: 5 ug of transfected 293T lysate (SMAD1), Lane 1: 5 ug of transfected 293T lysate (SMAD2), Lane 1: 5 ug of transfected 293T lysate (SMAD3), Lane 1: 5 ug of transfected 293T lysate (SMAD4), Lane 1: 5 ug of transfected 293T lysate (SMAD5), Lane 1: 5 ug of transfected 293T lysate (SMAD6), Lane 1: 5 ug of transfected 293T lysate (SMAD7), Lane 1: 5 ug of transfected 293T lysate (SMAD8), Lane 1: 5 ug of transfected 293T lysate (GFP), Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit IgG HRP Conjugated, Secondary Antibody dilution: 1:10000, Gene Name: SMAD1.
WB Suggested Anti-SMAD1 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |