SLC7A5 Rabbit Polyclonal Antibody

• Catalog Number: orb585727
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A5
• Target: SLC7A5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
• UniProt ID: Q01650
• MW: 56kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E16, CD98, LAT1, 4F2LC, MPE16, D16S469E
• Research Area: Cell Biology, Neuroscience, Stem Cell & Developmen
• Note: For research use only
• NCBI: NP_003477

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-SLC7A5 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.