Cart summary

You have no items in your shopping cart.

SLC7A5 Rabbit Polyclonal Antibody (Biotin)

SLC7A5 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2093380

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093380
CategoryAntibodies
DescriptionSLC7A5 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
UniProt IDQ01650
MW56kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesE16, CD98, LAT1, 4F2LC, MPE16, D16S469E
NoteFor research use only
NCBINP_003477