You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324996 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Slc6a9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70kDa |
Target | Slc6a9 |
UniProt ID | P28571 |
Protein Sequence | Synthetic peptide located within the following region: FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE |
NCBI | NP_032161 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Anti-glycine transporter 1 antibody, anti-Glyt 1 a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.
WB | |
Bovine, Canine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |