Slc6a9 Rabbit Polyclonal Antibody

SKU: orb324996

Description

Rabbit polyclonal antibody to Slc6a9

Research Area

Cardiovascular Research, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Slc6a9
• Protein Sequence: Synthetic peptide located within the following region: FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE
• Molecular Weight: 70kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-glycine transporter 1 antibody, anti-Glyt 1 antibody, anti-GlyT-1 antibodyGlyT1 antibody, anti-SC6A9_HUMAN antibody, anti-SLC6A9 antibody, anti-sodium and chloride dependent glycine transporter 1 antibody, anti-Sodium-and chloride-dependent glycine transporter 1 antibody, anti-Solute carrier family 6 member 9 antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Quick Database Links

Gene Symbol

Slc6a9

UniProt

P28571

RefSeq (Protein):NP_032161