SLC6A9 Rabbit Polyclonal Antibody

SKU: orb325037

Description

Rabbit polyclonal antibody to SLC6A9

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC6A9
• Target: SLC6A9
• Protein Sequence: Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV
• Molecular Weight: 72kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-glycine transporter 1 antibody, anti-Glyt 1 antibody, anti-GlyT-1 antibodyGlyT1 antibody, anti-SC6A9_HUMAN antibody, anti-SLC6A9 antibody, anti-sodium and chloride dependent glycine transporter 1 antibody, anti-Sodium-and chloride-dependent glycine transporter 1 antibody, anti-Solute carrier family 6 member 9 antibody

Sample Type: THP-1 Whole cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

SLC6A9

UniProt

P48067