SLC4A2 Rabbit Polyclonal Antibody

• Catalog Number: orb578948
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC4A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 137kDa
• Target: SLC4A2
• UniProt ID: P04920
• Protein Sequence: Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
• NCBI: NP_003031
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AE2, HKB3, BND3L, NBND3, EPB3L1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-SLC4A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: ACHN cell lysate. SLC4A2 is supported by BioGPS gene expression data to be expressed in ACHN.