Cart summary

You have no items in your shopping cart.

SLC4A2 Rabbit Polyclonal Antibody (FITC)

SLC4A2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2120175

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2120175
CategoryAntibodies
DescriptionSLC4A2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW137kDa
UniProt IDP04920
Protein SequenceSynthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
NCBINP_003031
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesAE2, HKB3, BND3L, NBND3, EPB3L1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.