SLC41A1 Rabbit Polyclonal Antibody

• Catalog Number: orb325131
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC41A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: SLC41A1
• UniProt ID: Q8IVJ1
• Protein Sequence: Synthetic peptide located within the following region: TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP
• NCBI: NP_776253
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MgtE antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7 cell lysate, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/mL.

SLC41A1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325131 with 1:200 dilution. Western blot was performed using orb325131 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SLC41A1 IP with orb325131 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SLC41A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.