SLC41A2 Rabbit Polyclonal Antibody

• Catalog Number: orb579038
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC41A2
• Target: SLC41A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A2
• Protein Sequence: Synthetic peptide located within the following region: SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
• UniProt ID: Q96JW4
• MW: 53kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SLC41A1-L1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_115524
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SLC41A2 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.