You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578931 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC2A4 |
| Target | SLC2A4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A4 |
| Protein Sequence | Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV |
| UniProt ID | P14672 |
| MW | 55kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GLUT4 |
| Research Area | Cell Biology, Stem Cell & Developmental Biology |
| Note | For research use only |
| NCBI | NP_001033 |

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-SLC2A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review