SLC25A11 Rabbit Polyclonal Antibody

• Catalog Number: orb578962
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC25A11
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A11
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: SLC25A11
• UniProt ID: Q02978
• Protein Sequence: Synthetic peptide located within the following region: AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL
• NCBI: NP_003553
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OGC, PGL6, SLC20A4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): MCF7 (N10), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/ml.

WB Suggested Anti-SLC25A11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. SLC25A11 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.