SLC17A5 Rabbit Polyclonal Antibody

• Catalog Number: orb578988
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC17A5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC17A5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55 kDa
• Target: SLC17A5
• UniProt ID: Q9NRA2
• Protein Sequence: Synthetic peptide located within the following region: LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
• NCBI: NP_036566
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SD, AST, NSD, SLD, ISSD, SIASD, SIALIN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Positive control (+): THP1 Cell Lysate (N30), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 5 ug/ml.

Human Muscle

Rabbit Anti-SLC17A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC17A5 Antibody Titration: 0.5 ug/ml, Positive Control: 293T cells lysate.