Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC12A1 Rabbit Polyclonal Antibody

SKU: orb578031

Description

SLC12A1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC12A1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
TargetSLC12A1
Protein SequenceSynthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Molecular Weight47kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BSC1, NKCC2

Similar Products

  • SLC12A1 Rabbit Polyclonal Antibody [orb251575]

    IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SLC12A1 Rabbit Polyclonal Antibody [orb137939]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NKCC2 Antibody (APC) [orb152682]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
  • NKCC2 Antibody (Biotin) [orb152683]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μg
  • NKCC2 Antibody (FITC) [orb152684]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC12A1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in multiple isoforms including 46 kDa.

SLC12A1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/ml.

SLC12A1 Rabbit Polyclonal Antibody

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 5 ug/ml.

SLC12A1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

SLC12A1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

SLC12A1 Rabbit Polyclonal Antibody

Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

SLC12A1 Rabbit Polyclonal Antibody

Rabbit Anti-SLC12A1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

SLC12A1 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqAAH40138

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SLC12A1 Rabbit Polyclonal Antibody (orb578031)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry