You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578031 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC12A1 |
Target | SLC12A1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1 |
Protein Sequence | Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI |
UniProt ID | Q8IUN5 |
MW | 47kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BSC1, NKCC2 |
Note | For research use only |
NCBI | AAH40138 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in multiple isoforms including 46 kDa.
Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 5 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.
Rabbit Anti-SLC12A1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |