SIRT4 antibody

• Catalog Number: orb329660
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIRT4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIRT4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SIRT4
• UniProt ID: Q9Y6E7
• Protein Sequence: Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV
• NCBI: NP_036372
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC130046 antibody, anti MGC130047 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Raji tissue using SIRT4 antibody

Western blot analysis of MCF7 cell lysate tissue using SIRT4 antibody

Immunohistochemical staining of human Pancreas tissue using SIRT4 antibody

Western blot analysis of MCF7 tissue using SIRT4 antibody

Western blot analysis of human Liver tissue using SIRT4 antibody