You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329660 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SIRT4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SIRT4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | SIRT4 |
UniProt ID | Q9Y6E7 |
Protein Sequence | Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV |
NCBI | NP_036372 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC130046 antibody, anti MGC130047 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Pancreas
WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.
WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mL, Sample Type: Human Liver.
WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mL, Sample Type: Human Raji.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Drosophila, Equine, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |