Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SIRT4 Rabbit Polyclonal Antibody

SKU: orb329661

Description

SIRT4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SIRT4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT4. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer, DNA Damage

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SIRT4
TargetSIRT4
Protein SequenceSynthetic peptide located within the following region: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC130046 antibody, anti MGC130047 antibody, anti MGC57437 antibody, anti SIR2L4 antibody, anti sirtuin 4 antibody

Similar Products

  • SIRT4 Rabbit Polyclonal Antibody [orb546343]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SIRT4 Rabbit Polyclonal Antibody [orb329660]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SIRT4 Rabbit Polyclonal Antibody [orb101356]

    WB

    Bovine, Drosophila, Equine, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • SIRT4 Rabbit Polyclonal Antibody [orb631200]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SIRT4 Rabbit Polyclonal Antibody [orb382039]

    IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SIRT4 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/mL.

SIRT4 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

SIRT4 Rabbit Polyclonal Antibody

Positive control (+): HepG2 (HG), Negative control (-): THP-1 (N30), Antibody concentration: 3 ug/mL.

SIRT4 Rabbit Polyclonal Antibody

WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Small Intestine.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_036372

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SIRT4 Rabbit Polyclonal Antibody (orb329661)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry