Cart summary

You have no items in your shopping cart.

SIGIRR Rabbit Polyclonal Antibody (FITC)

SIGIRR Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112819

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112819
CategoryAntibodies
DescriptionSIGIRR Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SIGIRR
Protein SequenceSynthetic peptide located within the following region: PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
UniProt IDQ6IA17
MW25kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesTIR8, IL-1R8
NoteFor research use only
  • SIGIRR Rabbit Polyclonal Antibody (FITC) [orb190318]

    ICC,  IF

    Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl