Cart summary

You have no items in your shopping cart.

SIGIRR Rabbit Polyclonal Antibody (HRP)

SIGIRR Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2112818

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112818
CategoryAntibodies
DescriptionSIGIRR Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SIGIRR
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW25kDa
UniProt IDQ6IA17
Protein SequenceSynthetic peptide located within the following region: PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesTIR8, IL-1R8
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.
  • SIGIRR Rabbit Polyclonal Antibody (HRP) [orb478063]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl