You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576575 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SIAH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | SIAH1 |
UniProt ID | Q8IUQ4 |
Protein Sequence | Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP |
NCBI | NP_003022 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SIAH1A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Mouse Brain (M-BR), Negative control (-): Mouse Pancreas (M-PA), Antibody concentration: 1 ug/ml.
Lanes: Lane 1: 50 ug human HEK-293T lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-IgG, Secondary Antibody Dilution: 1:5000, Gene Name: SIAH1, SIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Liver
WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |