Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SIAH1 Rabbit Polyclonal Antibody

SKU: orb576575

Description

SIAH1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SIAH1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1
TargetSIAH1
Protein SequenceSynthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Molecular Weight31kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SIAH1A

Similar Products

  • SIAH1 Rabbit Polyclonal Antibody [orb329760]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb6951]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb340838]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • SIAH1/2 Rabbit Polyclonal Antibody [orb224178]

    IF,  IHC,  WB

    Gallus, Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb631179]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SIAH1 Rabbit Polyclonal Antibody

Positive control (+): Mouse Brain (M-BR), Negative control (-): Mouse Pancreas (M-PA), Antibody concentration: 1 ug/ml.

SIAH1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 50 ug human HEK-293T lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-IgG, Secondary Antibody Dilution: 1:5000, Gene Name: SIAH1, SIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

SIAH1 Rabbit Polyclonal Antibody

Liver

SIAH1 Rabbit Polyclonal Antibody

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003022

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SIAH1 Rabbit Polyclonal Antibody (orb576575)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry