SIAH1 Rabbit Polyclonal Antibody

• Catalog Number: orb329760
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIAH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIAH1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SIAH1
• UniProt ID: Q8IUQ4
• Protein Sequence: Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
• NCBI: NP_001006611
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SIAH1A antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SIAH1 antibody, Catalog Number: orb329760, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Application: Western blotting Species+tissue/cell type: Human embryonic kidney 293T How many ug’s of tissue/cell lysate run on the gel: 1: 50 ug human HEK-293T cell lysatePrimary antibody Dilution: 1:1000, Secondary antibody: Anti-rabbit-IgG Secondary antibody Dilution: 1:5000.

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.