You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| MW | 7425.86 Da |
|---|---|
| Purity | > 95% by hplc |
| Formula | C327H543N101O86S5 |
| Protein Sequence | H-Met-Phe-Ala-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Hazard Information | Non-Toxic |
| Disclaimer | For research use only |
Alternative Names
−, 63 aa peptide, MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ, sfTSLP
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days