You have no items in your shopping cart.
SF3B1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1 |
| Target | SF3B1 |
| Protein Sequence | Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR |
| Molecular Weight | 146 kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SF3B1 Rabbit Polyclonal Antibody [orb577507]
IHC, WB
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlSF3B1 Rabbit Polyclonal Antibody [orb577751]
IHC, WB
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also in an isoform of 54 kDa and the protein may be modified via citrullination, sumoylation, and/or phosphorylation.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Epidermal cells, Antibody Concentration: 16 ug/ml, Magnification: 400X.

WB Suggested Anti-SF3B1 Antibody Titration: 1.25 ug/ml, Positive Control: Human Thymus.
Documents Download
Request a Document
Protocol Information
SF3B1 Rabbit Polyclonal Antibody (orb577508)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








