Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SF3B1 Rabbit Polyclonal Antibody

SKU: orb577508

Description

SF3B1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SF3B1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1
TargetSF3B1
Protein SequenceSynthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
Molecular Weight146 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155

Similar Products

  • SF3B1 Antibody (N-term) [orb1936430]

    IHC-P,  WB

    Other

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SAP 155 rabbit pAb Antibody [orb766643]

    IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SF3B1 Rabbit Polyclonal Antibody [orb577507]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SF3B1 Rabbit Polyclonal Antibody [orb577751]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SF3B1 Antibody [orb671876]

    ELISA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SF3B1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also in an isoform of 54 kDa and the protein may be modified via citrullination, sumoylation, and/or phosphorylation.

SF3B1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

SF3B1 Rabbit Polyclonal Antibody

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

SF3B1 Rabbit Polyclonal Antibody

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

SF3B1 Rabbit Polyclonal Antibody

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Epidermal cells, Antibody Concentration: 16 ug/ml, Magnification: 400X.

SF3B1 Rabbit Polyclonal Antibody

WB Suggested Anti-SF3B1 Antibody Titration: 1.25 ug/ml, Positive Control: Human Thymus.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_036565

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SF3B1 Rabbit Polyclonal Antibody (orb577508)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry