SF3B1 Rabbit Polyclonal Antibody

• Catalog Number: orb577508
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SF3B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 146 kDa
• Target: SF3B1
• UniProt ID: O75533
• Protein Sequence: Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
• NCBI: NP_036565
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also in an isoform of 54 kDa and the protein may be modified via citrullination, sumoylation, and/or phosphorylation.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Epidermal cells, Antibody Concentration: 16 ug/ml, Magnification: 400X.

WB Suggested Anti-SF3B1 Antibody Titration: 1.25 ug/ml, Positive Control: Human Thymus.