SF3B1 Rabbit Polyclonal Antibody

• Catalog Number: orb577751
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SF3B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 87kDa
• Target: SF3B1
• UniProt ID: Q7Z497
• Protein Sequence: Synthetic peptide located within the following region: ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
• NCBI: AAH56155
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SF3B1 Antibody, Catalog Number: orb577751, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SF3B1 Antibody Titration: 0.3125 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. SF3B1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.