SERPINH1 Rabbit Polyclonal Antibody

• Catalog Number: orb592734
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SERPINH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Canine, Equine, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINH1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: SERPINH1
• UniProt ID: P50454
• Protein Sequence: Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
• NCBI: NP_001226
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: SERPINH1, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: SERPINH1.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-SERPINH1 Antibody, Titration: 1.25 ug/ml, Positive Control: Placenta cell lysate.