Cart summary

You have no items in your shopping cart.

SERPINH1 Rabbit Polyclonal Antibody (HRP)

SERPINH1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2081222

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2081222
CategoryAntibodies
DescriptionSERPINH1 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityCanine, Equine, Human, Mouse, Porcine, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SERPINH1
Protein SequenceSynthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
UniProt IDP50454
MW46kDa
Tested applicationsIP, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM
Read more...
NoteFor research use only
NCBINP_001226