SELENBP1 Rabbit Polyclonal Antibody

• Catalog Number: orb580344
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SELENBP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SELENBP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: SELENBP1
• UniProt ID: Q13228
• Protein Sequence: Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
• NCBI: AAH32997
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MTO, LPSB, SP56, hSBP, EHMTO, SBP56, HEL-S-134P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-SELENBP1 Antibody, Catalog Number: orb580344, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SELENBP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.