SELENBP1 Rabbit Polyclonal Antibody

• Catalog Number: orb580343
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SELENBP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SELENBP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: SELENBP1
• UniProt ID: Q13228
• Protein Sequence: Synthetic peptide located within the following region: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD
• NCBI: NP_003935
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MTO, LPSB, SP56, hSBP, EHMTO, SBP56, HEL-S-134P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SELENBP1 Antibody, Catalog Number: orb580343, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane (weak), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-SELENBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.

WB Suggested Anti-SELENBP1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-SELENBP1 antibody Titration: 1 ug/ml, Sample Type: Human liver.