SEC61A1 antibody

• Catalog Number: orb326528
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEC61A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: SEC61A1
• UniProt ID: P61619
• Protein Sequence: Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC
• NCBI: NP_037468
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSEC61 antibody, anti SEC61 antibody, anti SE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HT1080 Whole Cell tissue using SEC61A1 antibody

Western blot analysis of human Fetal Lung tissue using SEC61A1 antibody

Western blot analysis of human Placenta tissue using SEC61A1 antibody