SCD Rabbit Polyclonal Antibody

• Catalog Number: orb329692
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCD
• Target: SCD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCD
• Protein Sequence: Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
• UniProt ID: O00767
• MW: 41kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti SCD1 antibody, anti FADS5 antibody, anti SCDO
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_005054

Human Liver

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 0.5 ug/mL.

WB Suggested Anti-SCD Antibody Titration: 1.0 ug/mL, Positive Control: Human Liver.