You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326476 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SAA2 |
Target | SAA2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: GAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGL |
UniProt ID | P0DJI9 |
MW | 14 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SAA, SAA1 |
Note | For research use only |
NCBI | NP_110381 |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-SAA2 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell.
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |