Saa1 Rabbit Polyclonal Antibody

• Catalog Number: orb580275
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Saa1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Saa1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14 kDa
• Target: Saa1
• UniProt ID: P05366
• Protein Sequence: Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA
• NCBI: NP_033143
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Sa, Saa2, Saa-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Mouse Thymus lysates, Antibody dilution: 2.0 ug/ml.